PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G26170.1
Common NameATWRKY50, T19G15.20, WRKY50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 173aa    MW: 19291.2 Da    PI: 6.3536
Description WRKY DNA-binding protein 50
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G26170.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.83.9e-32112170159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDg++WrKYG+K+vk+s++pr+YY+C+  gCpvkk+ver+++dp++v++tYeg+Hnh+
  AT5G26170.1 112 LDDGFKWRKYGKKMVKNSPHPRNYYKCSVDGCPVKKRVERDRDDPSFVITTYEGSHNHS 170
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-3499171IPR003657WRKY domain
SuperFamilySSF1182907.06E-29105170IPR003657WRKY domain
PROSITE profilePS5081130.021107172IPR003657WRKY domain
SMARTSM007741.7E-37112171IPR003657WRKY domain
PfamPF031066.1E-26113169IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MNDADTNLGS SFSDDTHSVF EFPELDLSDE WMDDDLVSAV SGMNQSYGYQ TSDVAGALFS  60
GSSSCFSHPE SPSTKTYVAA TATASADNQN KKEKKKIKGR VAFKTRSEVE VLDDGFKWRK  120
YGKKMVKNSP HPRNYYKCSV DGCPVKKRVE RDRDDPSFVI TTYEGSHNHS SMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2799169474Probable WRKY transcription factor 4
2lex_A2e-2799169474Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT5G26170
AtGenExpressAT5G26170
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group II-c
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. WRKY50 and WRKY51 proteins mediate both salicylic acid- and low-18:1-dependent repression of jasmonic acid signaling.
    [PMID: 21030507]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G26170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8VWQ5
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G26170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0718470.0AY071847.1 Arabidopsis thaliana WRKY transcription factor 50 (WRKY50) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197989.21e-128putative WRKY transcription factor 50
SwissprotQ8VWQ51e-130WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLC0SVQ61e-128C0SVQ6_ARATH; Putative uncharacterized protein At5g26170 (Fragment)
STRINGAT5G26170.11e-127(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61212747
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Chen IP,Haehnel U,Altschmied L,Schubert I,Puchta H
    The transcriptional response of Arabidopsis to genotoxic stress - a high-density colony array study (HDCA).
    Plant J., 2003. 35(6): p. 771-86
    [PMID:12969430]
  4. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  5. Hass C, et al.
    The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis.
    EMBO J., 2004. 23(16): p. 3290-302
    [PMID:15282545]
  6. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  7. Gao QM,Venugopal S,Navarre D,Kachroo A
    Low oleic acid-derived repression of jasmonic acid-inducible defense responses requires the WRKY50 and WRKY51 proteins.
    Plant Physiol., 2011. 155(1): p. 464-76
    [PMID:21030507]
  8. Pi L, et al.
    Organizer-Derived WOX5 Signal Maintains Root Columella Stem Cells through Chromatin-Mediated Repression of CDF4 Expression.
    Dev. Cell, 2015. 33(5): p. 576-88
    [PMID:26028217]